PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp5g11130
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family GATA
Protein Properties Length: 308aa    MW: 34278.8 Da    PI: 5.0307
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp5g11130genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA59.83.4e-19231265135
       GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                Cs+Cg+ kTp+WR+gp g ktLCnaCG++y++ +l
  Tp5g11130 231 CSHCGVQKTPQWREGPLGAKTLCNACGVRYKSGRL 265
                *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.4E-8834308IPR016679Transcription factor, GATA, plant
SuperFamilySSF577162.09E-14224287No hitNo description
PROSITE profilePS5011412.255225261IPR000679Zinc finger, GATA-type
SMARTSM004017.2E-16225279IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.106.7E-15229263IPR013088Zinc finger, NHR/GATA-type
CDDcd002024.40E-15230278No hitNo description
PfamPF003203.4E-17231265IPR000679Zinc finger, GATA-type
PROSITE patternPS003440231256IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MALKNSNRKE KAVTDVAHND DEFDVDDLLD FSNDDEFDVD DLLDFSNDDI FVDDDADLET  60
QRNCGVSDEI TLHRSNDLST AGEDVEPLLS SSLAVPTDNL EDFDWFTNIV DDSFTPYWAP  120
TKKPALLTGD RRDPVEPVKE ESCFKPPLPV KSRTKRGRTR VSVWSLGSSS LNDSSSSSTT  180
SSSSSSAPSS PLWLSGAEIL DETVVNRQKK MNKKKNVMKN GGQTQTQTRR CSHCGVQKTP  240
QWREGPLGAK TLCNACGVRY KSGRLLPEYR PACSPTFSSE LHSNHHRKVI EMRRKKKTSD  300
DANEPGSN
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00404DAPTransfer from AT3G51080Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009149294.11e-113PREDICTED: GATA transcription factor 6
RefseqXP_009149301.11e-113PREDICTED: GATA transcription factor 6
RefseqXP_013619181.11e-113PREDICTED: GATA transcription factor 6-like
SwissprotQ9SD381e-111GATA6_ARATH; GATA transcription factor 6
TrEMBLA0A0D3A8F31e-113A0A0D3A8F3_BRAOL; Uncharacterized protein
TrEMBLM4FCR31e-113M4FCR3_BRARP; Uncharacterized protein
STRINGBra038882.1-P1e-113(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36982561
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51080.13e-81GATA transcription factor 6